PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10005641m
Common NameEUTSA_v10005641mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 28064.7 Da    PI: 6.9194
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10005641mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.98.7e-26959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien++ rqvtfskRr g++KK +ELSvLCda + +i+fs tgkl ey+s
  Thhalv10005641m  9 KKIENQTARQVTFSKRRSGLIKKTHELSVLCDAHIGLIVFSATGKLSEYCS 59
                     68***********************************************96 PP

2K-box45.43.5e-16841631296
            K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       + e+l++e++ L++e+++L+  +R + G+dL s+   eL  LeqqLe+s+ k+R++K++     +++l +k ++l+e+n+++ +
  Thhalv10005641m  84 DDREELYHEMEVLRRETHKLEFRLRPYHGQDLASIPPHELDGLEQQLEHSVLKVRERKQQ-----LDNLNRKRRMLEEDNNNMYR 163
                      567899***************99***********************************75.....69999999999999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SMARTSM004325.1E-39160IPR002100Transcription factor, MADS-box
CDDcd002652.59E-44279No hitNo description
SuperFamilySSF554553.53E-31291IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014861.5E-1683165IPR002487Transcription factor, K-box
PROSITE profilePS5129712.08786171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKIQIKK IENQTARQVT FSKRRSGLIK KTHELSVLCD AHIGLIVFSA TGKLSEYCSD  60
PPRMPELIER YLQTNGLRLP DPNDDREELY HEMEVLRRET HKLEFRLRPY HGQDLASIPP  120
HELDGLEQQL EHSVLKVRER KQQLDNLNRK RRMLEEDNNN MYRWLHEHRT AIEFQQAGID  180
TKPGEYQQFL EQLQYYNNHQ QQPNSVLQLA TLPSEIDPNY HLQLAQPNLQ NDPTAKID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-17159159Myocyte-specific enhancer factor 2B
1tqe_Q8e-17159159Myocyte-specific enhancer factor 2B
1tqe_R8e-17159159Myocyte-specific enhancer factor 2B
1tqe_S8e-17159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU1920290.0EU192029.1 Brassica napus MADS-box DNA-binding domain transcription factor (TT16.2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006394594.11e-177hypothetical protein EUTSA_v10005641mg
SwissprotQ8RYD91e-141TT16_ARATH; Protein TRANSPARENT TESTA 16
TrEMBLV4K1T51e-177V4K1T5_EUTSA; Uncharacterized protein
STRINGBra013028.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65062543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.11e-134MIKC_MADS family protein